The domain within your query sequence starts at position 5 and ends at position 111; the E-value for the vWA-TerF-like domain shown below is 2.5e-7.

CAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAQQRSASQYFVLLLLTDGAV
TDVEATCKAVVDASKLPMSVIIVGVGGADFEVMEQLDADGGPLRTRS

vWA-TerF-like

vWA-TerF-like
PFAM accession number:PF10138
Interpro abstract (IPR019303):

vWA domain fused to TerD domain typified by the TerF protein [(PUBMED:23044854)]. Sometimes it is found as solos.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry vWA-TerF-like