The domain within your query sequence starts at position 333 and ends at position 431; the E-value for the zf-4CXXC_R1 domain shown below is 4.3e-40.

YDKVLGNTCHQCRQKTIDTKTVCRNQSCGGVRGQFCGPCLRNRYGEDVRTALLDPKWTCP
PCRGICNCSYCRRRDGRCATGILIHLAKFYGYDNVKEYL

zf-4CXXC_R1

zf-4CXXC_R1
PFAM accession number:PF10497
Interpro abstract (IPR018866):

R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression. This domain is a four-CXXC zinc finger putative DNA-binding domain found at the C-terminal end of R1. The domain carries 12 cysteines of which four pairs are of the CXXC type [(PUBMED:15654081)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-4CXXC_R1