The domain within your query sequence starts at position 371 and ends at position 410; the E-value for the zf-C2H2_3 domain shown below is 1.6e-18.

QLVIDAGQKHFGTTVCKSCGMIYTASNPEDEIQHLQHHHR

zf-C2H2_3

zf-C2H2_3
PFAM accession number:PF13878
Interpro abstract (IPR028005):

This entry represents the zinc-inger domain of the acetyl-transferase ESCO. N-acetyltransferase ESCO1 and ESCO2 are required for the establishment of sister chromatid cohesion and couple the processes of cohesion and DNA replication to ensure that only sister chromatids become paired together. They act by mediating the acetylation of cohesin component SMC3 [(PUBMED:19907496)]. They feature a conserved C-terminal domain consisting of a H2C2 zinc finger motif and an acetyltransferase domain (IPR028009), while the diverse N-terminal domain is involved in chromosome binding and could target these proteins to different chromosome structures [(PUBMED:15958495)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-C2H2_3