The domain within your query sequence starts at position 17 and ends at position 70; the E-value for the zf-C2H2_7 domain shown below is 4.3e-40.

RSRKPKKPHYIPRPWGKPYNYKCFQCPFTCLEKSHLYNHMKYSLCKDSLSLLLD

zf-C2H2_7

 zf-C2H2_7
PFAM accession number:PF15269
Interpro abstract (IPR039064):

This entry represents a zinc finger found in ZNF750 and related proteins. ZNF750 is a transcription factor that controls epithelial homeostasis by inhibiting progenitor genes while inducing differentiation genes [ (PUBMED:25228645) ]. Proteins containing this domain also include proline-rich protein 35. Its function is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-C2H2_7