The domain within your query sequence starts at position 17 and ends at position 70; the E-value for the zf-C2H2_7 domain shown below is 4.3e-40.

RSRKPKKPHYIPRPWGKPYNYKCFQCPFTCLEKSHLYNHMKYSLCKDSLSLLLD

zf-C2H2_7

zf-C2H2_7
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-C2H2_7