The domain within your query sequence starts at position 28 and ends at position 92; the E-value for the zf-C3Hc3H domain shown below is 1e-19.
CSFTHRPCSQPRLEGQEFCIKHILEDKNAPFKQCSYVSTKNGKRCPSAAPKPEKKDGVSF CAEHA
zf-C3Hc3H |
 |
|---|
| PFAM accession number: | PF13891 |
|---|---|
| Interpro abstract (IPR025927): | This domain is likely to be the DNA-binding domain of chromatin re-modelling proteins and helicases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-C3Hc3H