The domain within your query sequence starts at position 336 and ends at position 402; the E-value for the zf-C3Hc3H domain shown below is 4.3e-23.
ACSGTVKGEQCTKQALPFTRHCFQHILLNRSQQLFSSCTAKFADGQQCSVPVFDITHQTP LCEEHAK
zf-C3Hc3H |
---|
PFAM accession number: | PF13891 |
---|---|
Interpro abstract (IPR025927): | This domain is likely to be the DNA-binding domain of chromatin re-modelling proteins and helicases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-C3Hc3H