The domain within your query sequence starts at position 655 and ends at position 694; the E-value for the zf-C4_Topoisom domain shown below is 5.9e-16.

VRKCPQCNKDMVLKTKKSGGFYLSCMGFPECRSAVWFPDS

zf-C4_Topoisom

zf-C4_Topoisom
PFAM accession number:PF01396
Interpro abstract (IPR013498):

DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks [(PUBMED:7770916)]. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [(PUBMED:12042765), (PUBMED:11395412)]. DNA topoisomerases are divided into two classes: type I enzymes (EC 5.99.1.2; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (EC 5.99.1.3; topoisomerases II, IV and VI) break double-strand DNA [(PUBMED:12596227)].

Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (Topo IA; bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (Topo IB; eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA. This function is vital for the processes of replication, transcription, and recombination. Unlike Topo IA enzymes, Topo IB enzymes do not require a single-stranded region of DNA or metal ions for their function. The type IB family of DNA topoisomerases includes eukaryotic nuclear topoisomerase I, topoisomerases of poxviruses, and bacterial versions of Topo IB [(PUBMED:17293019)]. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their C-terminal catalytic domain and the overall reaction mechanism with tyrosine recombinases [(PUBMED:21087076),(PUBMED:9488644)]. The C-terminal catalytic domain in topoisomerases is linked to a divergent N-terminal domain that shows no sequence or structure similarity to the N-terminal domains of tyrosine recombinases [(PUBMED:20644584),(PUBMED:17722649)].

This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc [(PUBMED:10873443)]. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc.

GO process:DNA topological change (GO:0006265)
GO component:chromosome (GO:0005694)
GO function:DNA topoisomerase activity (GO:0003916), DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-C4_Topoisom