The domain within your query sequence starts at position 3034 and ends at position 3103; the E-value for the zf-C4pol domain shown below is 8.2e-16.

CPVCDDLTQHGICSKCRSQPQHVAIILNQEIRELERKQEQLIKICRNCTGSFDRHIPCVS
LNCPVLFKLS

zf-C4pol

zf-C4pol
PFAM accession number:PF14260
Interpro abstract (IPR025687):

In fission yeast, this zinc-finger domain appears is the region of Pol3 that binds directly to the B-subunit, Cdc1 [(PUBMED:1960723)]. Pol delta is a hetero-tetrameric enzyme comprising four evolutionarily well-conserved proteins: the catalytic subunit Pol3 and three smaller subunits Cdc1, Cdc27 and Cdm1 [(PUBMED:19686603)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-C4pol