The domain within your query sequence starts at position 1261 and ends at position 1300; the E-value for the zf-CCHC_6 domain shown below is 1.2e-17.

KLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQE

zf-CCHC_6

zf-CCHC_6
PFAM accession number:PF15288
Interpro abstract (IPR041670):

This Zinc knuckle is found in FAM90A and transcription initiation factor TFIID proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-CCHC_6