The domain within your query sequence starts at position 1282 and ends at position 1321; the E-value for the zf-CCHC_6 domain shown below is 4.4e-18.
KLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQE
zf-CCHC_6 |
---|
PFAM accession number: | PF15288 |
---|---|
Interpro abstract (IPR041670): | This Zinc knuckle is found in FAM90A and transcription initiation factor TFIID proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-CCHC_6