The domain within your query sequence starts at position 404 and ends at position 640; the E-value for the zf-CpG_bind_C domain shown below is 2.1e-108.

AANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIIL
RAKQQAVREDEENNENDSDDTDLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMY
PTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPADEVCGCPLVRDVFELTGDF
CRLPKRQCNRHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALM

zf-CpG_bind_C

zf-CpG_bind_C
PFAM accession number:PF12269
Interpro abstract (IPR022056):

This domain family is found in eukaryotes, and is approximately 240 amino acids in length. This domain is the zinc finger domain of a CpG binding DNA methyltransferase protein. It contains a CxxC motif which forms the zinc finger and binds to DNA.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-CpG_bind_C