The domain within your query sequence starts at position 279 and ends at position 309; the E-value for the zf-NADH-PPase domain shown below is 2.7e-10.

SRYKFCPTCGSATKIEEGGYKRVCVRETCPS

zf-NADH-PPase

zf-NADH-PPase
PFAM accession number:PF09297
Interpro abstract (IPR015376):

This domain has a zinc ribbon structure and is often found between two NUDIX domains.

GO function:metal ion binding (GO:0046872), hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-NADH-PPase