The domain within your query sequence starts at position 104 and ends at position 246; the E-value for the zf-NPL4 domain shown below is 1.1e-61.

NVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMS
FHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHV
DNIMFENHTVADRFLDFWRKTGN

zf-NPL4

zf-NPL4
PFAM accession number:PF05020
Interpro abstract (IPR007716): The HRD4 gene is identical to NPL4, a gene previously implicated in nuclear transport. Using a diverse set of substrates and direct ubiquitination assays, analysis revealed that HRD4/NPL4 is required for a poorly characterised step in ER-associated degradation after ubiquitination of target proteins but before their recognition by the 26S proteasome [(PUBMED:11739805)]. This region of the protein contains possibly two zinc binding motifs. Npl4p physically associates with Cdc48p via Ufd1p to form a Cdc48p-Ufd1p-Npl4p complex. The Cdc48-Ufd1-Npl4 complex functions in the recognition of several polyubiquitin-tagged proteins and facilitates their presentation to the 26S proteasome for processive degradation or even more specific processing.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-NPL4