The domain within your query sequence starts at position 205 and ends at position 245; the E-value for the zf-RING-like domain shown below is 7.8e-13.
CNICHGLLIQGQSCETCGIRMHLPCVAKYFQSIPEPHCPHC
zf-RING-like |
 |
|---|
| PFAM accession number: | PF08746 |
|---|---|
| Interpro abstract (IPR014857): | This is a zinc finger domain that is related to the C3HC4 RING finger domain ( IPR001841 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-RING-like