The domain within your query sequence starts at position 42 and ends at position 111; the E-value for the zf-RING_10 domain shown below is 2.8e-36.

LSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVN
CYKKLCEYIT

zf-RING_10

zf-RING_10
PFAM accession number:PF16685
Interpro abstract (IPR032043):

This entry represents the N-terminal domain of the E3 ubiquitin-protein ligase Msl2. This domain binds Msl1 and exhibits ubiquitin E3 ligase activity towards H2B K34 [(PUBMED:23029009)].

GO function:ubiquitin protein ligase activity (GO:0061630)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-RING_10