The domain within your query sequence starts at position 42 and ends at position 111; the E-value for the zf-RING_10 domain shown below is 2.8e-36.
LSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVN CYKKLCEYIT
zf-RING_10 |
 |
|---|
| PFAM accession number: | PF16685 |
|---|---|
| Interpro abstract (IPR032043): | This entry represents the N-terminal domain of the E3 ubiquitin-protein ligase Msl2. This domain binds Msl1 and exhibits ubiquitin E3 ligase activity towards H2B K34 [ (PUBMED:23029009) ]. |
| GO function: | ubiquitin protein ligase activity (GO:0061630) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-RING_10