The domain within your query sequence starts at position 163 and ends at position 202; the E-value for the zf-RING_UBOX domain shown below is 4e-20.
CPILRQQTTDNNPPMKLVCGHIISRDALNKMFNGSKLKCP
zf-RING_UBOX |
---|
PFAM accession number: | PF13445 |
---|---|
Interpro abstract (IPR027370): | This zinc-finger is the dimerisation motif for LisH proteins [ (PUBMED:16445939) ]. This domain can also be found in the typical RING-type of plant ubiquitin ligases [ (PUBMED:15644464) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-RING_UBOX