The domain within your query sequence starts at position 169 and ends at position 211; the E-value for the zf-RING_UBOX domain shown below is 1.6e-9.

CPITQLEMKKPVKNKMCGHTYEEEAIVRMIESKHKRKKKACCP

zf-RING_UBOX

 zf-RING_UBOX
PFAM accession number:PF13445
Interpro abstract (IPR027370):

This zinc-finger is the dimerisation motif for LisH proteins [ (PUBMED:16445939) ]. This domain can also be found in the typical RING-type of plant ubiquitin ligases [ (PUBMED:15644464) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-RING_UBOX