The domain within your query sequence starts at position 63 and ends at position 133; the E-value for the zf-SAP30 domain shown below is 3e-39.
PGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSV RNRRKRKGSDD
zf-SAP30 |
---|
PFAM accession number: | PF13866 |
---|---|
Interpro abstract (IPR025717): | SAP30 is a subunit of the histone deacetylase complex, and this domain is a zinc-finger. Solution of the structure shows a novel fold comprising two beta-strands and two alpha-helices with the zinc organising centre showing remote resemblance to the treble clef motif. In silico analysis of the structure reveals a highly conserved surface dominated by basic residues. NMR-based analysis of potential ligands for the SAP30 Zn-finger motif indicate a strong preference for nucleic acid substrates. The zinc-finger of SAP30 probably functions as a double-stranded DNA-binding motif, thereby expanding the known functions of both SAP30 and the mammalian Sin3 co-repressor complex [ (PUBMED:19223330) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-SAP30