The domain within your query sequence starts at position 197 and ends at position 403; the E-value for the zf-SNAP50_C domain shown below is 3.3e-76.

YQTMLVLGSQKLTELRDSICCVSDLQIGGEFSNAPDQAPEHISKDLYKSAFFYFEGTFYN
DRRYPECRDLSRTIIEWSESHDRGYGKFQTARMEDFTFNDLHIKLGFPYLYCHQGDCEHV
VVITDIRLVHHDDCLDRTLYPLLTKKHWLWTRKCFVCKMYTARWVTNNDTFAPEDPCFFC
DVCFRMLHYDSEGNKLGEFLAYPYVDP

zf-SNAP50_C

zf-SNAP50_C
PFAM accession number:PF12251
Interpro abstract (IPR022042):

snRNA-activating protein complex 50 kDa subunit (SNAP50), also known as subunit 3, is part of the snRNA-activating protein complex which activates RNA polymerases II and III [(PUBMED:9003788)]. It contains a cysteine-histidine cluster with two possible zinc finger motifs.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-SNAP50_C