The domain within your query sequence starts at position 587 and ends at position 676; the E-value for the zf-TFIIIC domain shown below is 4.4e-26.

HISKKMNKQTFPERCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHD
SIARHPVPEDPDWIKRLLQSPCPFCDSPVF

zf-TFIIIC

zf-TFIIIC
PFAM accession number:PF12660
Interpro abstract (IPR024764):

This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins. This domain might be involved in protein-DNA and/or protein-protein interactions [(PUBMED:10523658)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-TFIIIC