The domain within your query sequence starts at position 135 and ends at position 191; the E-value for the zf-TRAF domain shown below is 4.6e-18.

HLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKH

zf-TRAF

zf-TRAF
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-TRAF