The domain within your query sequence starts at position 191 and ends at position 250; the E-value for the zf-TRAF domain shown below is 9.9e-14.

HEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAH

zf-TRAF

zf-TRAF
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-TRAF