The domain within your query sequence starts at position 16 and ends at position 46; the E-value for the zf-TRM13_CCCH domain shown below is 1.4e-17.
DGRCNYFVEKKKRFCRMVAAAGKRFCGEHAG
zf-TRM13_CCCH |
---|
PFAM accession number: | PF11722 |
---|---|
Interpro abstract (IPR021721): | This domain is found at the N terminus of TRM13 methyltransferase proteins. It is presumed to be a zinc binding domain. |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-TRM13_CCCH