The domain within your query sequence starts at position 2 and ends at position 67; the E-value for the zf-Tim10_DDP domain shown below is 3.8e-20.

EQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLM
AAYVHL

zf-Tim10_DDP

zf-Tim10_DDP
PFAM accession number:PF02953
Interpro abstract (IPR004217):

This domain has four conserved cysteine residues. It is found in proteins Tim8, Tim9, Tim10 and Tim13, which are involved in mitochondrial protein import [(PUBMED:11101512)] and seem to be localised to the mitochondrial intermembrane space. The Tim8-Tim13 complex has a complex architecture, similar to the Tim9-Tim10 complex, composed of a hexametric architecture with long helices which look like tentacles extend from a central loop [(PUBMED:18706423)]. In each subunit of the Tim9-Tim10 complex, a signature "twin CX3C" motif forms two intramolecular disulfides [(PUBMED:16387659)].

Defects in the Tim8A gene (DDP1) have been shown to be the cause of 2 human syndromes: Mohr-Tranebjaerg syndrome (MTS); also known as dystonia-deafness syndrome (DDS) or X-linked progressive deafness type 1 (DFN-1); and Jensen syndrome (JENSS); also known as opticoacoustic nerve atrophy with dementia.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-Tim10_DDP