The domain within your query sequence starts at position 15 and ends at position 58; the E-value for the zf-tcix domain shown below is 1e-22.

SDLGKATLRGIRKCPRCGTFNGTRGLSCKNKTCGTIFRYGARKQ

zf-tcix

zf-tcix
PFAM accession number:PF14952
Interpro abstract (IPR029269):

This entry represents a domain found in eukaryotic proteins. It resembles the zinc-binding domain of prokaryotic topoisomerases, IPR004149 .

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-tcix