The domain within your query sequence starts at position 250 and ends at position 300; the E-value for the zinc_ribbon_10 domain shown below is 7.4e-25.
ALDRIVEYLVGDGPQNRYALICQQCFSHNGMALKEEFEYIAFRCAYCFFLN
zinc_ribbon_10 |
---|
PFAM accession number: | PF10058 |
---|---|
Interpro abstract (IPR019273): | This domain, found mainly in the eukaryotic lunapark proteins, has no known function [ (PUBMED:12732147) ]. C. elegans lunapark-1 plays a role in synaptogenesis by regulating vesicular transport or localization [ (PUBMED:18279315) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zinc_ribbon_10