The domain within your query sequence starts at position 250 and ends at position 300; the E-value for the zinc_ribbon_10 domain shown below is 7.4e-25.

ALDRIVEYLVGDGPQNRYALICQQCFSHNGMALKEEFEYIAFRCAYCFFLN

zinc_ribbon_10

zinc_ribbon_10
PFAM accession number:PF10058
Interpro abstract (IPR019273):

This domain, found mainly in the eukaryotic lunapark proteins, has no known function [ (PUBMED:12732147) ]. C. elegans lunapark-1 plays a role in synaptogenesis by regulating vesicular transport or localization [ (PUBMED:18279315) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zinc_ribbon_10