The domain within your query sequence starts at position 150 and ends at position 210; the E-value for the zinc_ribbon_6 domain shown below is 3.1e-33.

ALDMTRYWRQLDTEVAQTPMPSEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNTA
Q

zinc_ribbon_6

zinc_ribbon_6
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zinc_ribbon_6