The domain within your query sequence starts at position 191 and ends at position 249; the E-value for the zinc_ribbon_6 domain shown below is 6.6e-32.

LDMTRYWRQLDTEVAQTPMPSEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNTA

zinc_ribbon_6

zinc_ribbon_6
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zinc_ribbon_6