The domain within your query sequence starts at position 32 and ends at position 176; the E-value for the Pro-kuma_activ domain shown below is 4.53e-50.

PPGWVSLGRVDPEEELSLTFALKQRNLERLSELVQAVSDPSSPQYGKYLTLEDVAELVQP
SPLTLLTVQKWLSAAGARNCDSVTTQDFLTCWLSVRQAELLLPGAEFHRYVGGPTKTHVI
RSPHPYQLPQALAPHVDFVGGLHRF

Pro-kuma_activ

Pro-kumamolisin, activation domain
Pro-kuma_activ
SMART accession number:SM00944
Description: This domain is found at the N-terminus of peptidases belonging to MEROPS peptidase family S53 (sedolisin, clan SB). The domain adopts a ferredoxin-like fold, with an alpha+beta sandwich. Cleavage of the domain results in activation of the peptidase (PUBMED:15242607).
Interpro abstract (IPR015366):

This domain is found at the N terminus of peptidases belonging to MEROPS peptidase family S53 (sedolisin, clan SB). The domain adopts a ferredoxin-like fold, with an alpha+beta sandwich. Cleavage of the domain results in activation of the peptidase [ (PUBMED:15242607) ].

GO function:serine-type peptidase activity (GO:0008236)
Family alignment:
View or

There are 6403 Pro-kuma_activ domains in 6400 proteins in SMART's nrdb database.

Click on the following links for more information.