The domain within your query sequence starts at position 32 and ends at position 176; the E-value for the Pro-kuma_activ domain shown below is 4.53e-50.
PPGWVSLGRVDPEEELSLTFALKQRNLERLSELVQAVSDPSSPQYGKYLTLEDVAELVQP SPLTLLTVQKWLSAAGARNCDSVTTQDFLTCWLSVRQAELLLPGAEFHRYVGGPTKTHVI RSPHPYQLPQALAPHVDFVGGLHRF
Pro-kuma_activPro-kumamolisin, activation domain |
---|
SMART accession number: | SM00944 |
---|---|
Description: | This domain is found at the N-terminus of peptidases belonging to MEROPS peptidase family S53 (sedolisin, clan SB). The domain adopts a ferredoxin-like fold, with an alpha+beta sandwich. Cleavage of the domain results in activation of the peptidase (PUBMED:15242607). |
Interpro abstract (IPR015366): | This domain is found at the N terminus of peptidases belonging to MEROPS peptidase family S53 (sedolisin, clan SB). The domain adopts a ferredoxin-like fold, with an alpha+beta sandwich. Cleavage of the domain results in activation of the peptidase [ (PUBMED:15242607) ]. |
GO function: | serine-type peptidase activity (GO:0008236) |
Family alignment: |
There are 6403 Pro-kuma_activ domains in 6400 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)