The domain within your query sequence starts at position 865 and ends at position 900; the E-value for the Pumilio domain shown below is 8.77e-7.

GPHSALYTMMKDQYANYVVQKMIDVAEPGQRKIVMH

Pumilio

Pumilio-like repeats
Pumilio
SMART accession number:SM00025
Description: Pumilio-like repeats that bind RNA.
Interpro abstract (IPR001313):

Members of the Pumilio family of proteins (Puf) regulate translation and mRNA stability in a wide variety of eukaryotic organisms including mammals, flies, worms, slime mold, and yeast [(PUBMED:10662662)]. Pumilio family members are characterised by the presence of eight tandem copies of an imperfectly repeated 36 amino acids sequence motif, the Pumilio repeat, surrounded by a short N- and C-terminal conserved region. The eight repeats and the N- and C-terminal regions form the Pumilio homology domain (PUM-HD). The PUM-HD domain is a sequence-specific RNA binding domain. Several Puf members have been shown to bind specific RNA sequences mainly found in the 3' UTR of mRNA and repress their translation [(PUBMED:14584586)]. Frequently, Puf proteins function asymmetrically to create protein gradients, thus causing asymmetric cell division and regulating cell fate specification [(PUBMED:1459455)].

Crystal structure of Pumilio repeats has been solved [(PUBMED:11336708)]. The PUM repeat with the N- and C-terminal regions pack together to form a right-handed superhelix that approximates a half doughnut structurally similar to the Armadillo (ARM) repeat proteins, beta-catenin and karyopherin alpha. The RNA binds the concave surface of the molecule, where each of the protein's eight repeats makes contacts with a different RNA base via three amino acid side chains at conserved positions [(PUBMED:12202039)].

This entry represents the Pumilio repeat.

GO function:RNA binding (GO:0003723)
Family alignment:
View or

There are 66335 Pumilio domains in 9739 proteins in SMART's nrdb database.

Click on the following links for more information.