The domain within your query sequence starts at position 885 and ends at position 920; the E-value for the Pumilio domain shown below is 4.03e-6.
EILQAAYQLMVDVFGNYVIQKFFEFGSHEQKLALAE
PumilioPumilio-like repeats |
---|
SMART accession number: | SM00025 |
---|---|
Description: | Pumilio-like repeats that bind RNA. |
Interpro abstract (IPR001313): | Members of the Pumilio family of proteins (Puf) regulate translation and mRNA stability in a wide variety of eukaryotic organisms including mammals, flies, worms, slime mold, and yeast [ (PUBMED:10662662) ]. Pumilio family members are characterised by the presence of eight tandem copies of an imperfectly repeated 36 amino acids sequence motif, the Pumilio repeat, surrounded by a short N- and C-terminal conserved region. The eight repeats and the N- and C-terminal regions form the Pumilio homology domain (PUM-HD). The PUM-HD domain is a sequence-specific RNA binding domain. The Puf family of proteins are mainly post-transcriptional regulators. Several Puf members have been shown to bind specific RNA sequences mainly found in the 3' UTR of mRNA and repress their translation [ (PUBMED:14584586) (PUBMED:29385744) ]. Frequently, Puf proteins function asymmetrically to create protein gradients, thus causing asymmetric cell division and regulating cell fate specification [ (PUBMED:1459455) ]. Crystal structure of Pumilio repeats has been solved [ (PUBMED:11336708) ]. The PUM repeat with the N- and C-terminal regions pack together to form a right-handed superhelix that approximates a half doughnut structurally similar to the Armadillo (ARM) repeat proteins, beta-catenin and karyopherin alpha. The RNA binds the concave surface of the molecule, where each of the protein's eight repeats makes contacts with a different RNA base via three amino acid side chains at conserved positions [ (PUBMED:12202039) ]. This entry represents the Pumilio repeat. |
GO function: | RNA binding (GO:0003723) |
Family alignment: |
There are 66335 Pumilio domains in 9739 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)