The domain within your query sequence starts at position 13 and ends at position 176; the E-value for the RAB domain shown below is 2.1e-95.

WARNING!
Some of the required catalytic sites were not detected in this domain. It is probably inactive! Check the literature (PubMed 99216537 20221439 ) for details.

Catalytic residues
PositionAmino acidPresent?
DomainProtein
5971QNo
FKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAGLE
RYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQA
REVPTEEACMFAENNGLLFLETSALDSTNVELAFQTVLKEIFAK

RAB

Rab subfamily of small GTPases
RAB
SMART accession number:SM00175
Description: Rab GTPases are implicated in vesicle trafficking.
Family alignment:
View or

There are 39024 RAB domains in 38982 proteins in SMART's nrdb database.

Click on the following links for more information.