The domain within your query sequence starts at position 2 and ends at position 118; the E-value for the RAB domain shown below is 3.53e-56.

All catalytic sites are present in this domain. Check the literature (PubMed 20221439 99216537 ) for details.

TIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIV
IMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIHLP

RAB

Rab subfamily of small GTPases
RAB
SMART accession number:SM00175
Description: Rab GTPases are implicated in vesicle trafficking.
Family alignment:
View or

There are 39024 RAB domains in 38982 proteins in SMART's nrdb database.

Click on the following links for more information.