The domain within your query sequence starts at position 742 and ends at position 801; the E-value for the RAP domain shown below is 6.92e-14.

IQFTNKNQYCYGSRALLGLHNMKRRQLVQIGYRVVELPHWEWLPLLKRTRLEKLAYLHEK

RAP

RAP
SMART accession number:SM00952
Description: This domain is found in various eukaryotic species, particularly in apicomplexans such as Plasmodium falciparum, where it is found in proteins that are important in various parasite-host cell interactions. It is thought to be an RNA-binding domain (PUBMED:15501674).
Interpro abstract (IPR013584):

The ~60-residue RAP (an acronym for RNA-binding domain abundant in Apicomplexans) domain is found in various proteins in eukaryotes. It is particularly abundant in apicomplexans and might mediate a range of cellular functions through its potential interactions with RNA [ (PUBMED:15501674) ].

The RAP domain consists of multiple blocks of charged and aromatics residues and is predicted to be composed of alpha helical and beta strand structures. Two predicted loop regions that are dominated by glycine and tryptophan residues are found before and after the central beta sheet [ (PUBMED:15501674) ].

Some proteins known to contain a RAP domain are listed below:

  • Human hypothetical protein MGC5297,
  • Mammalian FAST kinase domain-containing proteins (FASTKDs),
  • Chlamydomonas reinhardtii chloroplastic trans-splicing factor Raa3.
Family alignment:
View or

There are 3109 RAP domains in 3095 proteins in SMART's nrdb database.

Click on the following links for more information.