The domain within your query sequence starts at position 9 and ends at position 175; the E-value for the RAS domain shown below is 2.93e-53.

WARNING!
Some of the required catalytic sites were not detected in this domain. It is probably inactive! Check the literature (PubMed 12927549 1785141 ) for details.

Catalytic residues
PositionAmino acidPresent?
DomainProtein
1624KYes
6169QNo
AKDYRVVVLGSVAVGKTALATQFACGRFPERCEPSVEELFSKVIEVNRAPALLEIVDTVG
AEHLVTLKDLYIRNSDGFVVLYSVCDEASFQAVRPLRERMGRLRGSRAVPLVLVGTKADL
DAERQVLTAQGRALAREWRCPFLEITTKSKTMVDHVFTQVVREMEAL

RAS

Ras subfamily of RAS small GTPases
RAS
SMART accession number:SM00173
Description: Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors to protein kinase cascades
Family alignment:
View or

There are 10915 RAS domains in 10905 proteins in SMART's nrdb database.

Click on the following links for more information.