The domain within your query sequence starts at position 438 and ends at position 656; the E-value for the RFX5_DNA_bdg domain shown below is 4.29e-130.

LGPGRVPPRAPILPRGAENREVGISSDPRPHDKGIKRTAEVPLSEASGQDPPVKEMKHET
QDTTVSEAKRKRGRPRKKPGGSGERNATPEKSAAIVNSPRSPRLLWETWGSKRENNFIGR
PEGPGPGGEAERETVLVQGQQDGAVSKGERSLSSQEAKEAEDKIPPVTSKVSVIKGRIQK
EALQLVKGEADAATQGNKGLKGRVLQSSLTPEHKDPKAT

RFX5_DNA_bdg

RFX5 DNA-binding domain
RFX5_DNA_bdg
SMART accession number:SM01306
Description: RFX5 and RFXAP reveals molecular details associated with MHCII gene expression.
Interpro abstract (IPR029298):

Transcription of all the members of MHCII family of genes is controlled by a set of conserved transcription factors and promoter elements. One of these class II transactivators is the DNA-binding RFX complex, which consists of subunits RFX5 and its accessory proteins RFXAP and RFXANK [(PUBMED:10779326)].

This entry represents the C-terminal domain of RFX5. The C-terminal domain mediates cooperative binding between the RFX complex and NF-Y, a transcription factor binding to the Y box sequence of MHC-II promoters [(PUBMED:10779326)].

Family alignment:
View or

There are 128 RFX5_DNA_bdg domains in 128 proteins in SMART's nrdb database.

Click on the following links for more information.