The domain within your query sequence starts at position 8 and ends at position 118; the E-value for the RHO domain shown below is 1.4e-68.

All catalytic sites are present in this domain. Check the literature (PubMed 11995995 ) for details.

LVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYD
RLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNK

RHO

Rho (Ras homology) subfamily of Ras-like small GTPases
RHO
SMART accession number:SM00174
Description: Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Family alignment:
View or

There are 13543 RHO domains in 13489 proteins in SMART's nrdb database.

Click on the following links for more information.