The domain within your query sequence starts at position 57 and ends at position 439; the E-value for the RICTOR_N domain shown below is 4.02e-185.

LGHLNNFTKLLCDIGHSEEKLGFNYEDIIICLRLALLNEAKEVRAAGLRALRYLIQDSSI
LQKVLKLKVDYLIARCIDIQQSNEVERTQALRLVRKMITVNASLFPSSVANSLIAVGNDG
LQERDRMVRACIAIICELALQNPEVVALRGGLNTILKNVIDCQLSRINEALITTILHLLN
HPKTRQYVRADVELERILAPYTDFHYRHSPDTAEGQLKEDREARFLASKMGIIATFRSWA
GIINLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVTDEFIEALLSVDPG
RFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSD
DHISVRATILLGELLHMANTILP

RICTOR_N

Rapamycin-insensitive companion of mTOR, N-term
RICTOR_N
SMART accession number:SM01308
Description: Rictor appears to serve as a scaffolding protein that is important for maintaining mTORC2 integrity. The mammalian target of rapamycin (mTOR) is a conserved Ser/Thr kinase that forms two functionally distinct complexes, mTROC1 and mTORC2, important for nutrient and growth-factor signalling. This region is the N-terminal conserved section that may include several individual domains. Rictor can be inhibited in the short-term by rapamycin.
Interpro abstract (IPR028267):

The mammalian target of rapamycin (mTOR) is a conserved Ser/Thr kinase that forms two functionally distinct complexes, mTROC1 and mTORC2, important for nutrient and growth-factor signalling. Rictor (rapamycin-insensitive companion of mTOR) is a component of mTORC2 [(PUBMED:15268862)]. There is a regulatory link between the two mTOR complexes, whereby Rictor phosphorylation by mTORC1 regulates mTORC2 signalling [(PUBMED:19995915)]. Over-expression of Rictor increases mTORC2 activity and promotes cell growth and motility [(PUBMED:18089801)].

This domain is the N-terminal conserved section that may include several individual domains.

Family alignment:
View or

There are 1418 RICTOR_N domains in 1418 proteins in SMART's nrdb database.

Click on the following links for more information.