The domain within your query sequence starts at position 383 and ends at position 733; the E-value for the RNB domain shown below is 8.9e-140.

RRDLRKDCIFTIDPSTARDLDDALACRRLTDGTFEVGVHIADVSYFVPEGSSLDKVAAER
ATSVYLVQKVVPMLPRLLCEELCSLNPMTDKLTFSVIWKLTPEGKILEEWFGRTIIRSCT
KLSYDHAQSMIENPTEKIPEEELPPISPEHSVEEVHQAVLNLHSIAKQLRRQRFVDGALR
LDQLKLAFTLDHETGLPQGCHIYEYRDSNKLVEEFMLLANMAVAHKIFRTFPEQALLRRH
PPPQTKMLSDLVEFCDQMGLPMDVSSAGALNKSLTKTFGDDKYSLARKEVLTNMYSRPMQ
MALYFCSGMLQDQEQFRHYALNVPLYTHFTSPIRRFADVIVHRLLAAALGY

RNB

RNB
SMART accession number:SM00955
Description: This domain is the catalytic domain of ribonuclease II.(PUBMED:16806266)
Family alignment:
View or

There are 28471 RNB domains in 28454 proteins in SMART's nrdb database.

Click on the following links for more information.