The domain within your query sequence starts at position 1 and ends at position 49; the E-value for the RPT_1 domain shown below is 2.44e-6.

MFLIFHDFQFSCHIPCPTVDISFPPFSVFLAIFHVLKCVFLIFRDFQFS

This is a significant internal repeat in the query protein sequence, as detected by the Prospero program.