SMART: Internal repeat

The domain within your query sequence starts at position 592 and ends at position 745; the E-value for the RPT_1 domain shown below is 2.05e-22.

GARGKPGLPGMPGSDGLPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPRGVKGVDGIRGLK
GHKGEKGEDGFPGFKGDIGVKGDRGEVGVPGSRGEDGPEGPKGRTGPTGDPGPTGLMGEK
GKLGVPGLPGYPGRQGPKGSLGFPGFPGASGEKG

The domain within your query sequence starts at position 592 and ends at position 745; the E-value for the RPT_1 domain shown below is 2.05e-22.

This is a significant internal repeat in the query protein sequence, as detected by the Prospero program.