The domain within your query sequence starts at position 9 and ends at position 51; the E-value for the RPT_2 domain shown below is 2.4e-6.

DHQQRCLQEAENKHSESMFALQGRYEEEIRCMVEQLSHTENTL

This is a significant internal repeat in the query protein sequence, as detected by the Prospero program.