The domain within your query sequence starts at position 1087 and ends at position 1201; the E-value for the RQC domain shown below is 1.43e-15.

DVTDDVKNIIRFVQEHSSSPGTRNIGPAGRFTLNMLVDIFLGSKSAKVKSGIFGKGTTYS
RHNAERLFKKLILDKILDEDLYINANDQPIAYVMLGTKAHSVLSGHLKVDFMETE

RQC

RQC
SMART accession number:SM00956
Description: This DNA-binding domain is found in the RecQ helicase among others and has a helix-turn-helix structure. The RQC domain, found only in RecQ family enzymes, is a high affinity G4 DNA binding domain (PUBMED:16530788).
Interpro abstract (IPR018982):

This entry represents the RQC domain, which is a DNA-binding domain found only in RecQ family enzymes. RecQ family helicases can unwind G4 DNA, and play important roles at G-rich domains of the genome, including the telomeres, rDNA, and immunoglobulin switch regions. This domain has a helix-turn-helix structure and acts as a high affinity G4 DNA binding domain [ (PUBMED:16530788) ]. Binding of RecQ to Holliday junctions involves both the RQC and the HRDC domains.

GO process:DNA repair (GO:0006281), DNA replication (GO:0006260)
GO function:3'-5' DNA helicase activity (GO:0043138)
Family alignment:
View or

There are 16583 RQC domains in 16578 proteins in SMART's nrdb database.

Click on the following links for more information.