The domain within your query sequence starts at position 285 and ends at position 358; the E-value for the RRM domain shown below is 1.79e-25.

CIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIAS
LNGYRLGERVLQVS

RRM

RNA recognition motif
RRM
SMART accession number:SM00360
Description:
Interpro abstract (IPR000504): Many eukaryotic proteins that are known or supposed to bind single-stranded RNA contain one or more copies of a putative RNA-binding domain of about 90 amino acids. This is known as the eukaryotic putative RNA-binding region RNP-1 signature or RNA recognition motif (RRM). RRMs are found in a variety of RNA binding proteins, including heterogeneous nuclear ribonucleoproteins (hnRNPs), proteins implicated in regulation of alternative splicing, and protein components of small nuclear ribonucleoproteins (snRNPs). The motif also appears in a few single stranded DNA binding proteins. The RRM structure consists of four strands and two helices arranged in an alpha/beta sandwich, with a third helix present during RNA binding in some cases. Two individual models were built which identify subtypes of this domain, but there is no functional difference between the subtypes.
GO function:RNA binding (GO:0003723)
Family alignment:
View or

There are 14432 RRM domains in 8767 proteins in SMART's nrdb database.

Click on the following links for more information.