The domain within your query sequence starts at position 884 and ends at position 947; the E-value for the RUN domain shown below is 4.9e-22.

ARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYF
CFTN

RUN

RUN
SMART accession number:SM00593
Description: domain involved in Ras-like GTPase signaling
Interpro abstract (IPR004012):

The RUN domain, named after RPIP8, unc-14 and NESCA, is organised into six conserved blocks (A-F), which are predicted to constitute the 'core' of a globular structure tolerating insertions of considerable length between the conserved blocks. The RUN domain is found in one or two copies in several proteins that are linked particularly to the functions of GTPases in the Rap and Rab families. RUN domains can be associated with TBC/rab GAP, FYVE, DENN, SH3, DAG/PE-binding, PLAT/LH2, PH or PX domains. The RUN domain may have a role in the interaction of various proteins with cytoskeletal filaments [(PUBMED:11509568)].

The predicted secondary structures of the RUN domain core indicate a predominantly alpha fold [(PUBMED:11166556)].

Family alignment:
View or

There are 11118 RUN domains in 10051 proteins in SMART's nrdb database.

Click on the following links for more information.