The domain within your query sequence starts at position 562 and ends at position 707; the E-value for the RasGEFN domain shown below is 5.8e-52.

SGIPIIKGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLNLLIERFEIPEPEP
TEADKLALEKGEQPISADLKRFRKEYVQPVQLRVLNVFRHWVEHHYYDFERDLELLERLE
SFISSVRGKAMKKWVESIAKIIKRKK

RasGEFN

Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal motif
RasGEFN
SMART accession number:SM00229
Description: A subset of guanine nucleotide exchange factor for Ras-like small GTPases appear to possess this domain N-terminal to the RasGef (Cdc25-like) domain. The recent crystal structureof Sos shows that this domain is alpha-helical and plays a "purely structural role" (Nature 394, 337-343).
Interpro abstract (IPR000651):

The N-terminal domain of guanine nucleotide exchange factor (GEF) for Ras-like GTPases is also called REM domain (Ras exchanger motif). REM contacts the GTPase and is assumed to participate in the catalytic activity of the exchange factor. Proteins with the REM domain include Sos1 and Sos2, which relay signals from tyrosine-kinase mediated signalling to Ras, RasGRP1-4, RasGRF1,2, CNrasGEF, and RAP-specific nucleotide exchange factors, to name a few [(PUBMED:18541156), (PUBMED:18236214), (PUBMED:7786285), (PUBMED:8259209), (PUBMED:8479541), (PUBMED:16452984), (PUBMED:12628188), (PUBMED:9690470)].

The crystal structure of the GEF region of human Sos1 complexes with Ras has been solved [(PUBMED:9690470)]. The structure consists of two distinct alpha helical structural domains: the N-terminal domain which seems to have a purely structural role and the C-terminal domain which is sufficient for catalytic activity and contains all residues that interact with Ras. A main feature of the catalytic domain is the protrusion of a helical hairpin important for the nucleotide-exchange mechanism. The N-terminal domain is likely to be important for the stability and correct placement of the hairpin structure.

This entry represents a domain found in several GEF for Ras-like small GTPases which lies N-terminal to the RasGef (Cdc25-like) domain.

Family alignment:
View or

There are 13658 RasGEFN domains in 12887 proteins in SMART's nrdb database.

Click on the following links for more information.