The domain within your query sequence starts at position 743 and ends at position 857; the E-value for the RasGEF_N_2 domain shown below is 1.26e-54.

NVEFFNNWGIELLVTQLHDKNKTISSEALDILDEACEDKANLHALIQMKPALSHLGDKGL
LLLLRFLSIPKGFSYLNERGYVAKQLEKWHKEYNSKYVDLIEEQLNEALTTYRKP

RasGEF_N_2

Rapamycin-insensitive companion of mTOR RasGEF_N domain
RasGEF_N_2
SMART accession number:SM01303
Description: Rictor appears to serve as a scaffolding protein that is important for maintaining mTORC2 integrity. The mammalian target of rapamycin (mTOR) is a conserved Ser/Thr kinase that forms two functionally distinct complexes, mTROC1 and mTORC2, important for nutrient and growth-factor signalling. This region is the more conserved central section that may include several individual domains. Rictor can be inhibited in the short-term by rapamycin.
Family alignment:
View or

There are 1502 RasGEF_N_2 domains in 1502 proteins in SMART's nrdb database.

Click on the following links for more information.