The domain within your query sequence starts at position 7 and ends at position 95; the E-value for the Robl_LC7 domain shown below is 2.65e-10.

LTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNE
DSLKFILMDCMEGRVAITRVANLLLCMYA

Robl_LC7

Roadblock/LC7 domain
Robl_LC7
SMART accession number:SM00960
Description: This family includes proteins that are about 100 amino acids long and have been shown to be related (PUBMED:11084347). Members of this family of proteins are associated with both flagellar outer arm dynein and Drosophila and rat brain cytoplasmic dynein. It is proposed that roadblock/LC7 family members may modulate specific dynein functions (PUBMED:10402468). This family also includes Golgi-associated MP1 adapter protein and MglB from Myxococcus xanthus, a protein involved in gliding motility (PUBMED:2464581). However the family also includes members from non-motile bacteria such as Streptomyces coelicolor, suggesting that the protein may play a structural or regulatory role.
Interpro abstract (IPR004942):

This domain can be found in the roadblock proteins and LAMTOR2 proteins.

Dynein light chain roadblock proteins (DYNLRB1 and DYNLRB2) are non-catalytic accessory components of the cytoplasmic dynein 1 complex. The dynein light chains are required for the correct assembly of the dynein complex and have been implicated in controlling its association with cargo molecules. DYNLRB1 and DYNLRB2 can also be found in the dynein-2 complex [(PUBMED:25205765)].

LAMTOR2 is part of the ragulator complex involved in amino acid sensing and activation of mTORC1, a signalling complex promoting cell growth in response to growth factors, energy levels, and amino acids [(PUBMED:20381137), (PUBMED:22980980)].

Family alignment:
View or

There are 13442 Robl_LC7 domains in 13380 proteins in SMART's nrdb database.

Click on the following links for more information.