The domain within your query sequence starts at position 67 and ends at position 151; the E-value for the SAM_PNT domain shown below is 6.32e-30.
LAVLHLAEKASWTSERPQFWSKTQVLEWISYQVEKNKYDASSIDFSRCDMDGATLCSCAL EELRLVFGPLGDQLHAQLRDLTSNS
SAM_PNTSAM / Pointed domain |
---|
SMART accession number: | SM00251 |
---|---|
Description: | A subfamily of the SAM domain |
Interpro abstract (IPR003118): | The highly conserved PNT (or Pointed) domain is found within a subset of the Ets transcription factors, including mammalian Ets-1, Ets-2, Erg, Fli-1, GABPalpha, and Tel, as well as Drosophila Pnt-P2 and Yan. The PNT domain is structurally related to the larger group of SAM domains through a common tertiary arrangement of four alpha-helices. A role in protein-protein association has been established for the PNT domain [ (PUBMED:10828014) (PUBMED:15351649) ]. |
GO function: | sequence-specific DNA binding (GO:0043565) |
Family alignment: |
There are 5576 SAM_PNT domains in 5570 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)