The domain within your query sequence starts at position 47 and ends at position 159; the E-value for the SCAN domain shown below is 4.18e-71.

PDRSRQRFRAFRYPEAAGPRQALSRLRELCRQWLRPDMHSKEQILELLVLEQFLTILPGE
LQAWVREQHPDSGEEVVALLEYLDRQLDDTPPQVPDDDDGQELLCSKAVLLTS

SCAN

leucine rich region
SCAN
SMART accession number:SM00431
Description: -
Interpro abstract (IPR003309): A number of C2H2-zinc finger proteins contain a highly conserved N-terminal motif termed the SCAN (named after SRE-ZBP, CTfin51, AW-1 and Number 18 cDNA) domain. The SCAN domain has been shown to be able to mediate homo- and hetero-oligomerisation [(PUBMED:10567577)]. This domain defines a large family of zinc finger transcription factors [(PUBMED:12801630)].
GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:DNA binding transcription factor activity (GO:0003700)
Family alignment:
View or

There are 9360 SCAN domains in 9259 proteins in SMART's nrdb database.

Click on the following links for more information.